Further processing options

Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können

Druckausg.: Kant, Immanuel, 1724 - 1804, Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können, 5. Aufl., Leipzig : Meiner, 1913, XLVI, 208 S.
Authors and Corporations: Kant, Immanuel (Author), Vorländer, Karl (Editor)
Title Statement: Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können/ mit Einl., Beil., Pers.- u. Sachreg. hrsg. von Karl Vorländer
Edition: 5. Aufl.
Type of Resource: E-Book
Leipzig Meiner 1913
Online-Ausg.. Leipzig UBL 2018
Series: Philosophische Bibliothek <Hamburg> ; 40
Physical Description: XLVI, 208 S.
RVK Notation:
CF 5004
  • Geschichte der Philosophie
    • Geschichte der Philosophie des Abendlandes von Antike bis 20. Jahrhundert
      • Philosophie des 17. und 18. Jahrhunderts
        • Autoren
          • Autoren K
            • Kant, Immanuel
              • Einzelschriften
LEADER 05578cam a22015132 4500
001 0-1656319756
003 DE-627
005 20220617101740.0
007 cr uuu---uuuuu
008 180518s1913 xx |||||o 00| ||ger c
024 7 |a urn:nbn:de:bsz:15-0011-167494  |2 urn 
035 |a (DE-627)1656319756 
035 |a (DE-576)505322048 
035 |a (DE-599)BSZ505322048 
035 |a (OCoLC)1039151124 
040 |a DE-627  |b ger  |c DE-627  |e rakwb 
041 |a ger 
084 |a CF 5004  |2 rvk  |0 (DE-625)rvk/18105:11603 
100 1 |a Kant, Immanuel  |d 1724-1804  |0 (DE-588)118559796  |0 (DE-627)133368785  |0 (DE-576)208982949  |4 aut 
245 1 0 |a Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können  |c mit Einl., Beil., Pers.- u. Sachreg. hrsg. von Karl Vorländer 
246 1 |i Ansetzungssachtitel  |a Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können 
250 |a 5. Aufl. 
264 1 |a Leipzig  |b Meiner  |c 1913 
300 |a XLVI, 208 S. 
336 |a Text  |b txt  |2 rdacontent 
337 |a Computermedien  |b c  |2 rdamedia 
338 |a Online-Ressource  |b cr  |2 rdacarrier 
490 1 |a Philosophische Bibliothek  |v 40 
506 0 |q DE-15  |a Open Access  |e Controlled Vocabulary for Access Rights  |u http://purl.org/coar/access_right/c_abf2 
533 |a Online-Ausg.  |b Leipzig  |c UBL  |d 2018  |e Online-Ressource  |7 |2018|||||||||| 
535 1 |a UB Leipzig 
540 |q DE-15  |a Public Domain Mark 1.0  |f PDM 1.0  |2 cc  |u https://creativecommons.org/publicdomain/mark/1.0/ 
583 1 |a Archivierung/Langzeitarchivierung gewährleistet  |2 pdager  |5 DE-15 
700 1 |a Vorländer, Karl  |d 1860-1928  |e Hrsg.  |0 (DE-588)11749366X  |0 (DE-627)13433762X  |0 (DE-576)163442495  |4 edt 
776 0 8 |i Druckausg.  |a Kant, Immanuel, 1724 - 1804  |t Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können  |b 5. Aufl.  |d Leipzig : Meiner, 1913  |h XLVI, 208 S.  |w (DE-627)1086479130  |w (DE-576)016479130 
830 0 |a Philosophische Bibliothek <Hamburg>  |v 40  |9 40,5  |w (DE-627)725592796  |w (DE-576)505854376  |w (DE-600)2680729-4 
856 4 0 |u http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-167494  |x Digitalisierung  |y Online-Zugriff  |z kostenfrei  |3 Volltext 
856 4 0 |u https://iiif.ub.uni-leipzig.de/0000008057/manifest.json  |x Digitalisierung  |y IIIF-Manifest  |3 Volltext 
856 4 2 |u http://d-nb.info/580334074/04  |m B:DE-101  |q application/pdf  |3 Inhaltsverzeichnis 
912 |a ZDB-175-LEV 
936 r v |a CF 5004  |b Einzelschriften  |k Geschichte der Philosophie  |k Geschichte der Philosophie des Abendlandes von Antike bis 20. Jahrhundert  |k Philosophie des 17. und 18. Jahrhunderts  |k Autoren  |k Autoren K  |k Kant, Immanuel  |k Einzelschriften  |0 (DE-627)1271507951  |0 (DE-625)rvk/18105:11603  |0 (DE-576)201507951 
951 |a BO 
900 |a Kant, Imānūīl 
900 |a Kant, Immanuïl 
900 |a Kant, Immanuelʹ 
900 |a Kant, Immānū'ēl 
900 |a Kant, Imanuell 
900 |a Kant, Immanowel 
900 |a Kantius 
900 |a Kanto, Imanueru 
900 |a Kānt, ʿImānūʾīl 
900 |a Kānt, ʿAmānūʾīl 
900 |a Ḳanṭ, ʿImanuʾel 
900 |a Kānṭ, ʿAmmānūʾīl 
900 |a Cant 
900 |a Kanti, Imanuel 
900 |a Kants, Imanuels 
900 |a Kants, Immanuēls 
900 |a Kantas, I. 
900 |a Kantas, Imanuelis 
900 |a Pseudo-Kant 
900 |a Yi man nu er Kang de 
900 |a Yimannuer-Kangde 
900 |a Kangde, Yimannuer 
900 |a Kang de 
900 |a Kangde 
900 |a Kant, Immanuil 
900 |a Kant, Imm. 
900 |a Kant, Inmanuel 
900 |a Kant, Manuel 
900 |a Kant 
900 |a Qanṭ, Immānū'ēl 
900 |a Kanto 
900 |a K'ang-tê, I. 
900 |a K'ang-tê 
900 |a Kānt 
900 |a Kānṭ, Imainual 
900 |a Kānt, ʿImānūīl 
900 |a Kant, Imanuwil 
900 |a Kant, Immanual 
900 |a Kant, Immanuell 
900 |a Kanto, I. 
900 |a Kant, Imanuel 
900 |a Kant, I. 
900 |a Kant, Emanuel 
900 |a Kant, Emanuele 
900 |a Kant, Emmanuel 
900 |a Kant, Emmanuele 
900 |a Kant, E. 
900 |a Kant, Manuele 
900 |a Kant, M. 
900 |a Kantius, Immanuel 
900 |a Kant, Imanuil 
900 |a Kant, Amanuil 
900 |a K`ant`u 
900 |a Canto, I. 
900 |a Kant, Im. 
900 |a Kant, `Imanu'el 
900 |a Kānt, `Ammānūʹīl 
900 |a Kant, IImmanuil 
900 |a Kantius, Immanowel 
900 |a Kant, Imainual 
900 |a K`ang-te 
900 |a Кант, И. 
900 |a Кант, Иммануел 
900 |a Кант, Иммануил 
900 |a イマヌエル・カント 
900 |a カント, イマヌエル 
900 |a 康德, 伊曼纽尔 
900 |a קאנט, עמנואל 
900 |a קנט, עמנואל 
900 |a Кант, Імануель 
900 |a Кант, Иммануэл 
900 |a Vorlaender, Karl 
900 |a Vorlaender, K. 
900 |a Vorländer, Carl 
900 |a Vorländer, C. 
900 |a Vorländer-Metzke 
900 |a Forlender, K. 
951 |b XA-DE 
852 |a DE-15  |x epn:3387295286  |z 2018-05-18T00:00:00Z 
856 4 0 |u http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-167494  |9 LFER 
970 |c OD 
971 |c EBOOK 
972 |c EBOOK 
973 |c EB 
935 |a lfer 
852 |a LFER  |x epn:3387295367  |z 2018-05-24T00:00:00Z 
980 |a 1656319756  |b 0  |k 1656319756  |o 505322048  |c lfer 
openURL url_ver=Z39.88-2004&ctx_ver=Z39.88-2004&ctx_enc=info%3Aofi%2Fenc%3AUTF-8&rfr_id=info%3Asid%2Fvufind.svn.sourceforge.net%3Agenerator&rft.title=Immanuel+Kants+Prolegomena+zu+einer+jeden+k%C3%BCnftigen+Metaphysik%2C+die+als+Wissenschaft+wird+auftreten+k%C3%B6nnen&rft.date=1913&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Adc&rft.creator=Kant%2C+Immanuel&rft.pub=Meiner&rft.format=eBook&rft.language=German
_version_ 1804868183471947777
access_state_str Open Access
author Kant, Immanuel
author2 Vorländer, Karl
author2_role edt
author2_variant k v kv
author_facet Kant, Immanuel, Vorländer, Karl
author_role aut
author_sort Kant, Immanuel 1724-1804
author_variant i k ik
collection ZDB-175-LEV, lfer
ctrlnum (DE-627)1656319756, (DE-576)505322048, (DE-599)BSZ505322048, (OCoLC)1039151124
de15_date 2018-05-18T00:00:00Z
edition 5. Aufl.
facet_912a ZDB-175-LEV
facet_avail Online, Free
finc_class_facet Philosophie
finc_id_str 0021106846
fincclass_txtF_mv philosophy
format eBook
format_access_txtF_mv Book, E-Book
format_de105 Ebook
format_de14 Book, E-Book
format_de15 Book, E-Book
format_del152 Buch
format_detail_txtF_mv text-online-monograph-independent
format_dezi4 e-Book
format_finc Book, E-Book
format_legacy ElectronicBook
format_legacy_nrw Book, E-Book
format_nrw Book, E-Book
format_strict_txtF_mv E-Book
geogr_code not assigned
geogr_code_person Germany
hierarchy_parent_id 0-725592796, ZDB-175-LEV
hierarchy_parent_title Philosophische Bibliothek <Hamburg>, Bücher aus Leipziger Verlagen 1851-1920
hierarchy_sequence 40,5,
hierarchy_top_id 0-725592796, ZDB-175-LEV
hierarchy_top_title Philosophische Bibliothek <Hamburg>, Bücher aus Leipziger Verlagen 1851-1920
id 0-1656319756
illustrated Not Illustrated
imprint Leipzig, Meiner, 1913
imprint_str_mv Leipzig: Meiner, 1913, Online-Ausg.: Leipzig: UBL, 2018
institution DE-D117, DE-105, LFER, DE-Ch1, DE-15, DE-14, DE-L242, DE-Zwi2
is_hierarchy_id 0-1656319756
is_hierarchy_title Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
kxp_id_str 1656319756
language German
last_indexed 2024-07-17T22:47:09.145Z
license_str_mv https://creativecommons.org/publicdomain/mark
marc024a_ct_mv urn:nbn:de:bsz:15-0011-167494
match_str kant1913immanuelkantsprolegomenazueinerjedenkunftigenmetaphysikdiealswissenschaftwirdauftretenkonnen
mega_collection Verbunddaten SWB, Lizenzfreie Online-Ressourcen, Digitale Sammlungen UBL / Leipziger Verlage 1851-1920
misc_de105 EBOOK
multipart_link 505854376
multipart_part (505854376)40
names_id_str_mv (DE-588)118559796, (DE-627)133368785, (DE-576)208982949, (DE-588)11749366X, (DE-627)13433762X, (DE-576)163442495
oclc_num 1039151124
physical XLVI, 208 S.
publishDate 1913
publishDateSort 1913
publishPlace Leipzig
publisher Meiner
record_format marcfinc
record_id 505322048
recordtype marcfinc
rvk_facet CF 5004
rvk_label Geschichte der Philosophie, Geschichte der Philosophie des Abendlandes von Antike bis 20. Jahrhundert, Philosophie des 17. und 18. Jahrhunderts, Autoren, Autoren K, Kant, Immanuel, Einzelschriften
rvk_path CF, CD - CK, CF 1300 - CF 9317, CA - CK, CF 5000 - CF 5117, CD 1100 - CI 8000, CF 5004, CF 5000 - CF 5017
rvk_path_str_mv CF, CD - CK, CF 1300 - CF 9317, CA - CK, CF 5000 - CF 5117, CD 1100 - CI 8000, CF 5004, CF 5000 - CF 5017
series Philosophische Bibliothek <Hamburg>, 40
series2 Philosophische Bibliothek ; 40
source_id 0
spelling Kant, Immanuel 1724-1804 (DE-588)118559796 (DE-627)133368785 (DE-576)208982949 aut, Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können mit Einl., Beil., Pers.- u. Sachreg. hrsg. von Karl Vorländer, Ansetzungssachtitel Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können, 5. Aufl., Leipzig Meiner 1913, XLVI, 208 S., Text txt rdacontent, Computermedien c rdamedia, Online-Ressource cr rdacarrier, Philosophische Bibliothek 40, DE-15 Open Access Controlled Vocabulary for Access Rights http://purl.org/coar/access_right/c_abf2, Online-Ausg. Leipzig UBL 2018 Online-Ressource |2018||||||||||, UB Leipzig, DE-15 Public Domain Mark 1.0 PDM 1.0 cc https://creativecommons.org/publicdomain/mark/1.0/, Archivierung/Langzeitarchivierung gewährleistet pdager DE-15, Vorländer, Karl 1860-1928 Hrsg. (DE-588)11749366X (DE-627)13433762X (DE-576)163442495 edt, Druckausg. Kant, Immanuel, 1724 - 1804 Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können 5. Aufl. Leipzig : Meiner, 1913 XLVI, 208 S. (DE-627)1086479130 (DE-576)016479130, Philosophische Bibliothek <Hamburg> 40 40,5 (DE-627)725592796 (DE-576)505854376 (DE-600)2680729-4, http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-167494 Digitalisierung Online-Zugriff kostenfrei Volltext, https://iiif.ub.uni-leipzig.de/0000008057/manifest.json Digitalisierung IIIF-Manifest Volltext, http://d-nb.info/580334074/04 B:DE-101 application/pdf Inhaltsverzeichnis, DE-15 epn:3387295286 2018-05-18T00:00:00Z, http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-167494 LFER, LFER epn:3387295367 2018-05-24T00:00:00Z
spellingShingle Kant, Immanuel, Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können, Philosophische Bibliothek <Hamburg>, 40
swb_id_str 505322048
title Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
title_alt Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
title_auth Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
title_full Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können mit Einl., Beil., Pers.- u. Sachreg. hrsg. von Karl Vorländer
title_fullStr Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können mit Einl., Beil., Pers.- u. Sachreg. hrsg. von Karl Vorländer
title_full_unstemmed Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können mit Einl., Beil., Pers.- u. Sachreg. hrsg. von Karl Vorländer
title_in_hierarchy 40. Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können (1913), Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können (1913)
title_short Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
title_sort immanuel kants prolegomena zu einer jeden künftigen metaphysik, die als wissenschaft wird auftreten können
title_unstemmed Immanuel Kants Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
url http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-167494, https://iiif.ub.uni-leipzig.de/0000008057/manifest.json, http://d-nb.info/580334074/04
urn urn:nbn:de:bsz:15-0011-167494
work_keys_str_mv AT kantimmanuel immanuelkantsprolegomenazueinerjedenkunftigenmetaphysikdiealswissenschaftwirdauftretenkonnen, AT vorlanderkarl immanuelkantsprolegomenazueinerjedenkunftigenmetaphysikdiealswissenschaftwirdauftretenkonnen, AT kantimmanuel prolegomenazueinerjedenkunftigenmetaphysikdiealswissenschaftwirdauftretenkonnen, AT vorlanderkarl prolegomenazueinerjedenkunftigenmetaphysikdiealswissenschaftwirdauftretenkonnen