Further processing options

Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können

Druckausg.: Kant, Immanuel, 1724 - 1804, Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können, 4. Aufl., Leipzig : Dürr, 1905, XLVI, 208 S.
Authors and Corporations: Kant, Immanuel (Author), Vorländer, Karl (Editor)
Title Statement: Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können/ Immanuel Kant. Hrsg. und mit einer Einl., drei Beil. sowie einem Personen- u. Sachreg. vers. von Karl Vorländer
Edition: 4. Aufl.
Type of Resource: E-Book
published:
Leipzig Dürr 1905
Online-Ausg.. Leipzig UBL 2018
Series: Philosophische Bibliothek <Hamburg> ; 40
Physical Description: XLVI, 208 S.
RVK Notation:
CF 5000
  • Geschichte der Philosophie
    • Geschichte der Philosophie des Abendlandes von Antike bis 20. Jahrhundert
      • Philosophie des 17. und 18. Jahrhunderts
        • Autoren
          • Autoren K
            • Kant, Immanuel
              • Gesamtausgaben, Werke, Gesammelte Werke
BF 4045
  • Philosophie
    • Quellen zur Philosophiegeschichte
      • Neuzeit (ca. 1500-1850)
        • Autoren K
          • Kant, Immanuel
            • Werke
DD 7460
  • Geschichte der Pädagogik und des Bildungswesens
    • Quellenschriften und Biografien, Pädagogische Klassiker
      • Einzelne Autoren
        • Autoren K
          • Kant, Immanuel
            • Primärliteratur
CF 5004
  • Geschichte der Philosophie
    • Geschichte der Philosophie des Abendlandes von Antike bis 20. Jahrhundert
      • Philosophie des 17. und 18. Jahrhunderts
        • Autoren
          • Autoren K
            • Kant, Immanuel
              • Einzelschriften
LEADER 06410cam a22015732 4500
001 0-1656354519
003 DE-627
005 20220617101815.0
007 cr uuu---uuuuu
008 180518s1905 xx |||||o 00| ||ger c
024 7 |a urn:nbn:de:bsz:15-0011-182282  |2 urn 
035 |a (DE-627)1656354519 
035 |a (DE-576)505331217 
035 |a (DE-599)BSZ505331217 
035 |a (OCoLC)1039159651 
040 |a DE-627  |b ger  |c DE-627  |e rakwb 
041 |a ger 
084 |a CF 5000  |2 rvk  |0 (DE-625)rvk/18105:11599 
084 |a BF 4045  |2 rvk  |0 (DE-625)rvk/10972:11596 
084 |a DD 7460  |2 rvk  |0 (DE-625)rvk/19410:11618 
084 |a CF 5004  |2 rvk  |0 (DE-625)rvk/18105:11603 
100 1 |a Kant, Immanuel  |d 1724-1804  |0 (DE-588)118559796  |0 (DE-627)133368785  |0 (DE-576)208982949  |4 aut 
245 1 0 |a Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können  |c Immanuel Kant. Hrsg. und mit einer Einl., drei Beil. sowie einem Personen- u. Sachreg. vers. von Karl Vorländer 
250 |a 4. Aufl. 
264 1 |a Leipzig  |b Dürr  |c 1905 
300 |a XLVI, 208 S. 
336 |a Text  |b txt  |2 rdacontent 
337 |a Computermedien  |b c  |2 rdamedia 
338 |a Online-Ressource  |b cr  |2 rdacarrier 
490 1 |a Philosophische Bibliothek <Leipzig>  |v 40 
506 0 |q DE-15  |a Open Access  |e Controlled Vocabulary for Access Rights  |u http://purl.org/coar/access_right/c_abf2 
533 |a Online-Ausg.  |b Leipzig  |c UBL  |d 2018  |e Online-Ressource  |7 |2018|||||||||| 
535 1 |a UB Leipzig 
540 |q DE-15  |a Public Domain Mark 1.0  |f PDM 1.0  |2 cc  |u https://creativecommons.org/publicdomain/mark/1.0/ 
583 1 |a Archivierung/Langzeitarchivierung gewährleistet  |2 pdager  |5 DE-15 
700 1 |a Vorländer, Karl  |d 1860-1928  |e Hrsg.  |0 (DE-588)11749366X  |0 (DE-627)13433762X  |0 (DE-576)163442495  |4 edt 
776 0 8 |i Druckausg.  |a Kant, Immanuel, 1724 - 1804  |t Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können  |b 4. Aufl.  |d Leipzig : Dürr, 1905  |h XLVI, 208 S.  |w (DE-627)1164068806  |w (DE-576)094068801 
830 0 |a Philosophische Bibliothek <Hamburg>  |v 40  |9 40,4  |w (DE-627)725592796  |w (DE-576)505854376  |w (DE-600)2680729-4 
856 4 0 |u http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-182282  |x Digitalisierung  |y Online-Zugriff  |z kostenfrei  |3 Volltext 
856 4 0 |u https://iiif.ub.uni-leipzig.de/0000008094/manifest.json  |x Digitalisierung  |y IIIF-Manifest  |3 Volltext 
912 |a ZDB-175-LEV 
935 |a mteo 
936 r v |a CF 5000  |b Gesamtausgaben, Werke, Gesammelte Werke  |k Geschichte der Philosophie  |k Geschichte der Philosophie des Abendlandes von Antike bis 20. Jahrhundert  |k Philosophie des 17. und 18. Jahrhunderts  |k Autoren  |k Autoren K  |k Kant, Immanuel  |k Gesamtausgaben, Werke, Gesammelte Werke  |0 (DE-627)1270645919  |0 (DE-625)rvk/18105:11599  |0 (DE-576)200645919 
936 r v |a BF 4045  |b Werke  |k Philosophie  |k Quellen zur Philosophiegeschichte  |k Neuzeit (ca. 1500-1850)  |k Autoren K  |k Kant, Immanuel  |k Werke  |0 (DE-627)1270720422  |0 (DE-625)rvk/10972:11596  |0 (DE-576)200720422 
936 r v |a DD 7460  |b Primärliteratur  |k Geschichte der Pädagogik und des Bildungswesens  |k Quellenschriften und Biografien, Pädagogische Klassiker  |k Einzelne Autoren  |k Autoren K  |k Kant, Immanuel  |k Primärliteratur  |0 (DE-627)1270768379  |0 (DE-625)rvk/19410:11618  |0 (DE-576)200768379 
936 r v |a CF 5004  |b Einzelschriften  |k Geschichte der Philosophie  |k Geschichte der Philosophie des Abendlandes von Antike bis 20. Jahrhundert  |k Philosophie des 17. und 18. Jahrhunderts  |k Autoren  |k Autoren K  |k Kant, Immanuel  |k Einzelschriften  |0 (DE-627)1271507951  |0 (DE-625)rvk/18105:11603  |0 (DE-576)201507951 
951 |a BO 
900 |a Kant, Imānūīl 
900 |a Kant, Immanuïl 
900 |a Kant, Immanuelʹ 
900 |a Kant, Immānū'ēl 
900 |a Kant, Imanuell 
900 |a Kant, Immanowel 
900 |a Kantius 
900 |a Kanto, Imanueru 
900 |a Kānt, ʿImānūʾīl 
900 |a Kānt, ʿAmānūʾīl 
900 |a Ḳanṭ, ʿImanuʾel 
900 |a Kānṭ, ʿAmmānūʾīl 
900 |a Cant 
900 |a Kanti, Imanuel 
900 |a Kants, Imanuels 
900 |a Kants, Immanuēls 
900 |a Kantas, I. 
900 |a Kantas, Imanuelis 
900 |a Pseudo-Kant 
900 |a Yi man nu er Kang de 
900 |a Yimannuer-Kangde 
900 |a Kangde, Yimannuer 
900 |a Kang de 
900 |a Kangde 
900 |a Kant, Immanuil 
900 |a Kant, Imm. 
900 |a Kant, Inmanuel 
900 |a Kant, Manuel 
900 |a Kant 
900 |a Qanṭ, Immānū'ēl 
900 |a Kanto 
900 |a K'ang-tê, I. 
900 |a K'ang-tê 
900 |a Kānt 
900 |a Kānṭ, Imainual 
900 |a Kānt, ʿImānūīl 
900 |a Kant, Imanuwil 
900 |a Kant, Immanual 
900 |a Kant, Immanuell 
900 |a Kanto, I. 
900 |a Kant, Imanuel 
900 |a Kant, I. 
900 |a Kant, Emanuel 
900 |a Kant, Emanuele 
900 |a Kant, Emmanuel 
900 |a Kant, Emmanuele 
900 |a Kant, E. 
900 |a Kant, Manuele 
900 |a Kant, M. 
900 |a Kantius, Immanuel 
900 |a Kant, Imanuil 
900 |a Kant, Amanuil 
900 |a K`ant`u 
900 |a Canto, I. 
900 |a Kant, Im. 
900 |a Kant, `Imanu'el 
900 |a Kānt, `Ammānūʹīl 
900 |a Kant, IImmanuil 
900 |a Kantius, Immanowel 
900 |a Kant, Imainual 
900 |a K`ang-te 
900 |a Кант, И. 
900 |a Кант, Иммануел 
900 |a Кант, Иммануил 
900 |a イマヌエル・カント 
900 |a カント, イマヌエル 
900 |a 康德, 伊曼纽尔 
900 |a קאנט, עמנואל 
900 |a קנט, עמנואל 
900 |a Кант, Імануель 
900 |a Кант, Иммануэл 
900 |a Vorlaender, Karl 
900 |a Vorlaender, K. 
900 |a Vorländer, Carl 
900 |a Vorländer, C. 
900 |a Vorländer-Metzke 
900 |a Forlender, K. 
951 |b XA-DE 
852 |a DE-15  |x epn:3387472390  |z 2018-05-18T00:00:00Z 
856 4 0 |u http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-182282  |9 LFER 
970 |c OD 
971 |c EBOOK 
972 |c EBOOK 
973 |c EB 
935 |a lfer 
852 |a LFER  |x epn:3387472463  |z 2018-05-24T00:00:00Z 
980 |a 1656354519  |b 0  |k 1656354519  |o 505331217  |c lfer 
openURL url_ver=Z39.88-2004&ctx_ver=Z39.88-2004&ctx_enc=info%3Aofi%2Fenc%3AUTF-8&rfr_id=info%3Asid%2Fvufind.svn.sourceforge.net%3Agenerator&rft.title=Prolegomena+zu+einer+jeden+k%C3%BCnftigen+Metaphysik%2C+die+als+Wissenschaft+wird+auftreten+k%C3%B6nnen&rft.date=1905&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Adc&rft.creator=Kant%2C+Immanuel&rft.pub=D%C3%BCrr&rft.format=eBook&rft.language=German
SOLR
_version_ 1804890932726726656
access_state_str Open Access
author Kant, Immanuel
author2 Vorländer, Karl
author2_role edt
author2_variant k v kv
author_facet Kant, Immanuel, Vorländer, Karl
author_role aut
author_sort Kant, Immanuel 1724-1804
author_variant i k ik
collection ZDB-175-LEV, lfer
ctrlnum (DE-627)1656354519, (DE-576)505331217, (DE-599)BSZ505331217, (OCoLC)1039159651
de15_date 2018-05-18T00:00:00Z
edition 4. Aufl.
facet_912a ZDB-175-LEV
facet_avail Online, Free
finc_class_facet Philosophie, Theologie und Religionswissenschaft, Pädagogik
finc_id_str 0021107764
fincclass_txtF_mv philosophy, religion, education
format eBook
format_access_txtF_mv Book, E-Book
format_de105 Ebook
format_de14 Book, E-Book
format_de15 Book, E-Book
format_del152 Buch
format_detail_txtF_mv text-online-monograph-independent
format_dezi4 e-Book
format_finc Book, E-Book
format_legacy ElectronicBook
format_legacy_nrw Book, E-Book
format_nrw Book, E-Book
format_strict_txtF_mv E-Book
geogr_code not assigned
geogr_code_person Germany
hierarchy_parent_id 0-725592796, ZDB-175-LEV
hierarchy_parent_title Philosophische Bibliothek <Hamburg>, Bücher aus Leipziger Verlagen 1851-1920
hierarchy_sequence 40,4,
hierarchy_top_id 0-725592796, ZDB-175-LEV
hierarchy_top_title Philosophische Bibliothek <Hamburg>, Bücher aus Leipziger Verlagen 1851-1920
id 0-1656354519
illustrated Not Illustrated
imprint Leipzig, Dürr, 1905
imprint_str_mv Leipzig: Dürr, 1905, Online-Ausg.: Leipzig: UBL, 2018
institution DE-D117, DE-105, LFER, DE-Ch1, DE-L152, DE-15, DE-14, DE-L242, DE-Kn38, DE-1972, DE-Zwi2
is_hierarchy_id 0-1656354519
is_hierarchy_title Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
kxp_id_str 1656354519
language German
last_indexed 2024-07-18T04:48:31.207Z
license_str_mv https://creativecommons.org/publicdomain/mark
marc024a_ct_mv urn:nbn:de:bsz:15-0011-182282
match_str kant1905prolegomenazueinerjedenkunftigenmetaphysikdiealswissenschaftwirdauftretenkonnen
mega_collection Verbunddaten SWB, Lizenzfreie Online-Ressourcen, Digitale Sammlungen UBL / Leipziger Verlage 1851-1920
misc_de105 EBOOK
multipart_link 505854376
multipart_part (505854376)40
names_id_str_mv (DE-588)118559796, (DE-627)133368785, (DE-576)208982949, (DE-588)11749366X, (DE-627)13433762X, (DE-576)163442495
oclc_num 1039159651
physical XLVI, 208 S.
publishDate 1905
publishDateSort 1905
publishPlace Leipzig
publisher Dürr
record_format marcfinc
record_id 505331217
recordtype marcfinc
rvk_facet CF 5000, BF 4045, DD 7460, CF 5004
rvk_label Geschichte der Philosophie, Geschichte der Philosophie des Abendlandes von Antike bis 20. Jahrhundert, Philosophie des 17. und 18. Jahrhunderts, Autoren, Autoren K, Kant, Immanuel, Gesamtausgaben, Werke, Gesammelte Werke, Philosophie, Quellen zur Philosophiegeschichte, Neuzeit (ca. 1500-1850), Werke, Geschichte der Pädagogik und des Bildungswesens, Quellenschriften und Biografien, Pädagogische Klassiker, Einzelne Autoren, Primärliteratur, Einzelschriften
rvk_path DD, BF 1980 - BF 7990, B, CF, BF, D, CF 5000, DD 5000 - DD 9900, CF 5004, BF 4045 - BF 4046, DD 7460 - DD 7461, BF 3000 - BF 4990, BF 4045, DD 5030 - DD 9900, BF 4045 - BF 4051, DD 7460 - DD 7701, CD - CK, CF 1300 - CF 9317, CA - CK, CF 5000 - CF 5117, DD 7460, CD 1100 - CI 8000, CF 5000 - CF 5017
rvk_path_str_mv DD, BF 1980 - BF 7990, B, CF, BF, D, CF 5000, DD 5000 - DD 9900, CF 5004, BF 4045 - BF 4046, DD 7460 - DD 7461, BF 3000 - BF 4990, BF 4045, DD 5030 - DD 9900, BF 4045 - BF 4051, DD 7460 - DD 7701, CD - CK, CF 1300 - CF 9317, CA - CK, CF 5000 - CF 5117, DD 7460, CD 1100 - CI 8000, CF 5000 - CF 5017
series Philosophische Bibliothek <Hamburg>, 40
series2 Philosophische Bibliothek <Leipzig> ; 40
source_id 0
spelling Kant, Immanuel 1724-1804 (DE-588)118559796 (DE-627)133368785 (DE-576)208982949 aut, Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können Immanuel Kant. Hrsg. und mit einer Einl., drei Beil. sowie einem Personen- u. Sachreg. vers. von Karl Vorländer, 4. Aufl., Leipzig Dürr 1905, XLVI, 208 S., Text txt rdacontent, Computermedien c rdamedia, Online-Ressource cr rdacarrier, Philosophische Bibliothek <Leipzig> 40, DE-15 Open Access Controlled Vocabulary for Access Rights http://purl.org/coar/access_right/c_abf2, Online-Ausg. Leipzig UBL 2018 Online-Ressource |2018||||||||||, UB Leipzig, DE-15 Public Domain Mark 1.0 PDM 1.0 cc https://creativecommons.org/publicdomain/mark/1.0/, Archivierung/Langzeitarchivierung gewährleistet pdager DE-15, Vorländer, Karl 1860-1928 Hrsg. (DE-588)11749366X (DE-627)13433762X (DE-576)163442495 edt, Druckausg. Kant, Immanuel, 1724 - 1804 Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können 4. Aufl. Leipzig : Dürr, 1905 XLVI, 208 S. (DE-627)1164068806 (DE-576)094068801, Philosophische Bibliothek <Hamburg> 40 40,4 (DE-627)725592796 (DE-576)505854376 (DE-600)2680729-4, http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-182282 Digitalisierung Online-Zugriff kostenfrei Volltext, https://iiif.ub.uni-leipzig.de/0000008094/manifest.json Digitalisierung IIIF-Manifest Volltext, DE-15 epn:3387472390 2018-05-18T00:00:00Z, http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-182282 LFER, LFER epn:3387472463 2018-05-24T00:00:00Z
spellingShingle Kant, Immanuel, Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können, Philosophische Bibliothek <Hamburg>, 40
swb_id_str 505331217
title Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
title_auth Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
title_full Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können Immanuel Kant. Hrsg. und mit einer Einl., drei Beil. sowie einem Personen- u. Sachreg. vers. von Karl Vorländer
title_fullStr Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können Immanuel Kant. Hrsg. und mit einer Einl., drei Beil. sowie einem Personen- u. Sachreg. vers. von Karl Vorländer
title_full_unstemmed Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können Immanuel Kant. Hrsg. und mit einer Einl., drei Beil. sowie einem Personen- u. Sachreg. vers. von Karl Vorländer
title_in_hierarchy 40. Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können (1905), Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können (1905)
title_short Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
title_sort prolegomena zu einer jeden künftigen metaphysik, die als wissenschaft wird auftreten können
title_unstemmed Prolegomena zu einer jeden künftigen Metaphysik, die als Wissenschaft wird auftreten können
url http://nbn-resolving.de/urn:nbn:de:bsz:15-0011-182282, https://iiif.ub.uni-leipzig.de/0000008094/manifest.json
urn urn:nbn:de:bsz:15-0011-182282
work_keys_str_mv AT kantimmanuel prolegomenazueinerjedenkunftigenmetaphysikdiealswissenschaftwirdauftretenkonnen, AT vorlanderkarl prolegomenazueinerjedenkunftigenmetaphysikdiealswissenschaftwirdauftretenkonnen